IGF-1 LR3 1mg

Name: IGF-1 LR3 1mg
SKU: p-1775052559751-x-73
Availability: InStock

$89.99

Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.

Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.

Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.

Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.

🔥 Exclusive Crypto Offer

Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.

⚡ Don't have crypto? Buy it here in 5 minutes with easy guidance.

SKU: p-1775052559751-x-73 Category: Growth Hormone & IGF Research Modulators

Description

Buy IGF-1 LR3 1mg Online – Best Quality IGF-1 LR3 1mg for Sale

Are you looking to buy IGF-1 LR3 1mg for your laboratory research? You have come to the right place. At Pure Lab Peptides Store, we have IGF-1 LR3 1mg in stock and ready for immediate shipment. Our products are synthesized to the highest standards, ensuring that you receive the most reliable results for your scientific investigations.

When you search for IGF-1 LR3 1mg for sale, it is crucial to find a supplier that prioritizes purity and transparency. Our IGF-1 LR3 1mg is tested for consistency and stability, making it one of the top choices for researchers globally. Whether you are conducting metabolic studies or exploring cellular signaling, our high-purity IGF-1 LR3 1mg is designed to meet the rigorous demands of modern science.

IGF-1 LR3 1mg Highlights

Promotes potent IGF-1R tyrosine kinase phosphorylation to interrogate PI3K/Akt and MAPK/ERK intracellular signaling pathway cross-talk.
Stimulates mitogenic responses in vitro to delineate specific mechanisms governing cellular proliferation and survival under experimental conditions.
Facilitates the analysis of protein translation efficiency and metabolic flux within primary myogenic or osteogenic cell cultures.
Utilized as a high-affinity ligand for competitive binding assays and characterizing endocrine-mediated signal transduction kinetics in vitro.

Key Benefits of Purchasing IGF-1 LR3 1mg from Pure Lab Peptides

Premium Purity: Every batch of IGF-1 LR3 1mg is tested to meet or exceed 99% purity.
Fast Shipping: We know your research can’t wait. That’s why we keep IGF-1 LR3 1mg in stock for quick dispatch.
Competitive Pricing: Get the best price for IGF-1 LR3 1mg without compromising on quality.
Expert Support: Our team is here to assist you with any technical questions regarding your purchase.
Research Grade: Specifically designed for laboratory use, providing reliable and reproducible data.

Understanding IGF-1 LR3 1mg: Science and Research Applications

The research surrounding IGF-1 LR3 1mg has expanded significantly in recent years. This peptide is primarily investigated for its unique properties in biochemical pathways. Scientists choose to buy IGF-1 LR3 1mg online from us because we provide the documentation and quality assurance necessary for professional-grade research.

In various laboratory models, IGF-1 LR3 1mg has shown remarkable potential in influencing cellular mechanisms. Its structure allows for precise interaction with target receptors, facilitating a deeper understanding of biological processes. Our IGF-1 LR3 1mg is produced via solid-phase synthesis, ensuring a purity level that is often unmatched in the industry. For researchers focusing on the latest advancements, having access to in-stock IGF-1 LR3 1mg at a competitive price is a major advantage.

Moreover, the stability of our lyophilized powder format means that IGF-1 LR3 1mg remains potent for extended periods when stored correctly. This is vital for long-term projects where consistency is key. We invite you to explore the full range of possibilities with this extraordinary compound.

Specifications

CAS No.	946870-92-4
Purity	≥99%
Sequence	MFPAMPLSSLFVNAGPVCGLRIFYNNKQYWNKPTGYGSSIRRAPQTGIVDCCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula	C331H519N109O101
Molecular Weight	9117.60 g/mol
Synthesis	Solid-phase synthesis
Format	Lyophilized powder
Solubility	Soluble in water or 1% acetic acid
Stability & Storage	Stable for up to 24 months at -20°C. After reconstitution, may be stored at 4°C for up to 4 weeks or at -20°C for up to 6 months.
Applications	Cell growth and differentiation studies, muscle development and aging research, therapeutic research in muscle wasting and metabolic disorders
Appearance	White lyophilized powder
Shipping Conditions	Shipped at ambient temperature; once received, store at -20°C
Regulatory/Compliance	Manufactured in a facility that adheres to cGMP guidelines
Safety Information	Refer to provided MSDS

For more information on peer-reviewed studies involving similar compounds, you can visit PubMed.

Related Products You Might Interest In

Chonluten 20mg – Buy online at best price.
PT-141 10mg – Buy online at best price.
CJC-1295 + GHRP-2 (10mg Blend) – Buy online at best price.
PNC-27 30mg – Buy online at best price.
Melanotan II 10mg – Buy online at best price.
Pure Lab Peptides Store – Your one-stop shop for high-quality research peptides.

Disclaimer: ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are intended solely for research and laboratory use. These products are not intended for human or animal consumption. They are not medicines or drugs and have not been evaluated or approved by the FDA to diagnose, treat, cure, or prevent any disease or medical condition. Any form of bodily introduction is strictly prohibited by law.